PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G50750.1
Common NameBEH1, F18B3.30, T3A5.130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family BES1
Protein Properties Length: 276aa    MW: 30111.6 Da    PI: 9.7821
Description BES1/BZR1 homolog 1
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G50750.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822209.39.9e-65101441146
       DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqssl 98 
                  +++gr+ptwkErEnnk+RERrRRaiaaki++GLR+qGnyklpk++DnneVlkALc eAGw+v++DGttyrkgs+p+         +++ p+ss+q+s+
  AT3G50750.1  10 AATGRMPTWKERENNKKRERRRRAIAAKIFTGLRSQGNYKLPKHCDNNEVLKALCLEAGWIVHEDGTTYRKGSRPT---------ETTVPCSSIQLSP 98 
                  5799************************************************************************.........8999********* PP

       DUF822  99 kssalaspvesysaspksssfpspssldsislasaasllpvlsvlslv 146
                  +ssa++sp++sy+asp+sss+psp+++d ++++  + l+p+l++l+++
  AT3G50750.1  99 QSSAFQSPIPSYQASPSSSSYPSPTRFDPNQSS--TYLIPYLQNLASS 144
                  ******************************776..9******999764 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.6E-5712141IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005773Cellular Componentvacuole
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MTASGGGSTA ATGRMPTWKE RENNKKRERR RRAIAAKIFT GLRSQGNYKL PKHCDNNEVL  60
KALCLEAGWI VHEDGTTYRK GSRPTETTVP CSSIQLSPQS SAFQSPIPSY QASPSSSSYP  120
SPTRFDPNQS STYLIPYLQN LASSGNLAPL RISNSAPVTP PISSPRRSNP RLPRWQSSNF  180
PVSAPSSPTR RLHHYTSIPE CDESDVSTVD SCRWGNFQSV NVSQTCPPSP TFNLVGKSVS  240
SVGVDVSVKP WEGEKIHDVG IDDLELTLGH NTKGRG
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306933520.0
Genevisible252178_at0.0
Expression AtlasAT3G50750-
AtGenExpressAT3G50750-
ATTED-IIAT3G50750-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G50750.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDbrassinosteroid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G50750
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0024520.0BT002452.1 Arabidopsis thaliana putative protein (At3g50750) mRNA, complete cds.
GenBankBT0063100.0BT006310.1 Arabidopsis thaliana At3g50750 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_190644.10.0BES1/BZR1 1
SwissprotQ9S7F30.0BEH1_ARATH; BES1/BZR1 homolog protein 1
TrEMBLD7LTI11e-154D7LTI1_ARALL; Putative uncharacterized protein
STRINGAT3G50750.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM144671721
Representative plantOGRP37191024
Publications ? help Back to Top
  1. Wang ZY, et al.
    Nuclear-localized BZR1 mediates brassinosteroid-induced growth and feedback suppression of brassinosteroid biosynthesis.
    Dev. Cell, 2002. 2(4): p. 505-13
    [PMID:11970900]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Carter C, et al.
    The vegetative vacuole proteome of Arabidopsis thaliana reveals predicted and unexpected proteins.
    Plant Cell, 2004. 16(12): p. 3285-303
    [PMID:15539469]
  4. Yin Y, et al.
    A new class of transcription factors mediates brassinosteroid-regulated gene expression in Arabidopsis.
    Cell, 2005. 120(2): p. 249-59
    [PMID:15680330]
  5. Lee BH,Henderson DA,Zhu JK
    The Arabidopsis cold-responsive transcriptome and its regulation by ICE1.
    Plant Cell, 2005. 17(11): p. 3155-75
    [PMID:16214899]
  6. Cao D,Cheng H,Wu W,Soo HM,Peng J
    Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 509-25
    [PMID:16920880]
  7. Hectors K,Prinsen E,De Coen W,Jansen MA,Guisez Y
    Arabidopsis thaliana plants acclimated to low dose rates of ultraviolet B radiation show specific changes in morphology and gene expression in the absence of stress symptoms.
    New Phytol., 2007. 175(2): p. 255-70
    [PMID:17587374]